PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013905143.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 849aa    MW: 90464.9 Da    PI: 10.1917
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013905143.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.1e-1487129346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eEd  l + v ++G+ +W+ +a+ +  gR +k+c++rw +
   XP_013905143.1  87 PWTQEEDASLREQVSLHGPQNWSHVAKALK-GRNGKSCRLRWVN 129
                      8****************************9.***********88 PP

2Myb_DNA-binding52.41.2e-16139182348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++T+eEd +l++a+k lG++ W++Ia+ ++ gRt++ +k+rw+ +l
   XP_013905143.1 139 SFTPEEDTILLEAHKVLGNK-WTAIAKLLP-GRTDNAIKNRWHAWL 182
                      69******************.*********.***********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7880131IPR017930Myb domain
SuperFamilySSF466891.72E-2984178IPR009057Homeodomain-like
SMARTSM007177.9E-1284133IPR001005SANT/Myb domain
PfamPF002493.5E-1387130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2387138IPR009057Homeodomain-like
CDDcd001672.92E-1187129No hitNo description
PROSITE profilePS5129424.3132186IPR017930Myb domain
SMARTSM007173.0E-16136184IPR001005SANT/Myb domain
PfamPF002495.1E-15139182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-23139185IPR009057Homeodomain-like
CDDcd001671.56E-12139182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 849 aa     Download sequence    Send to blast
MGHSGNPTAG SGKEGPMPSQ NRTPVKRLPS KPANRKKDAG AAVAPQATPA VRGGGAAKPP  60
RSGRAADAKQ EGKEKLLQEL RTTNYRPWTQ EEDASLREQV SLHGPQNWSH VAKALKGRNG  120
KSCRLRWVNQ LAPDLKQESF TPEEDTILLE AHKVLGNKWT AIAKLLPGRT DNAIKNRWHA  180
WLKKKFPQQA AAVAAASAAA GAAAGAAAAA KPSNADIRGG GKAGNGIKRA ASGRAAASEQ  240
QKPLVAAAAA PPPPPEKGIP QPPEVTAAAA AAAVASPALT RQLEIERQLF SALRVKGHAE  300
LASQLEAQMV RPTQPRLPPP ERRARLAQLL EASGHQALAS GLRQFAEGAA NGVRPSAGYW  360
DGGEQGSKAG TASLEEASAC RSGLLDERDM GAGGSATATS GDATAQIKAQ LPPAAVMAAA  420
PSLAPNNRHQ RQQQRVRLAI QRRQRQQQQQ QQQQQQQEPQ ARQQQGQLEQ RQHRHQQLRQ  480
QEQQELHEQQ EQQELHEQQE QQEQQEQQEQ QEQQEQQEQQ EQQEQQEQQE QQERKQQQQQ  540
QQPLQQQQQQ QQQRSASAIG SPLQQQQQHQ HQHQHQHQHQ HHQQQQHQQQ QHQQHQHHHP  600
QQQHQQHQQH QQHQQHSRKR LLPPDSGALL ELPFGQAPLD DNPDRPGSPI LNVLPGSVVS  660
LQTLGVTSGV TSSEAAPDGP EPLQLPAAAP AHAAATAWAT AEALVAAAAA AGSAAGSAAG  720
AGAREQGRAL KRVRLELNGA IGGTAVERRA LPLLGFGKGG KGAQPAHKHA PGAATLAAAP  780
RVGAAGDGCG GGGDDEELPG SFLVGSFAGS LGNLLGSFEG STLSAGQLLG RHDSFEAGAA  840
AARGGPSGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-33871859107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1320326ERRARLA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013905143.10.0Transforming protein Myb
TrEMBLA0A0D2LI460.0A0A0D2LI46_9CHLO; Transforming protein Myb
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.12e-37myb domain protein 110
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]